Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2576c/MT2652 (Rv2576c, MT2652)

This Recombinant Uncharacterized protein Rv2576c/MT2652 (Rv2576c, MT2652) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2576c/MT2652

UniProt

P65021

Expression Region

1-154

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAGVGNASGSVLDMTSVRTVPSAVALVTFAGAALSGVIPAIARADPVGHQVTYTVTTTS DLMANIRYMSADPPSMAAFNADSSKYMITLHTPIAGGQPLVYTATLANPSQWAIVTASGG LRVNPEFHCEIVVDGQVVVSQDGGSGVQCSTRPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF740 conjugate, 0.1mg/mL
BNC740732-500 1x 500 µL

TAG-72 / CA72.4 (CC49), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF594 conjugate, 0.1mg/mL
BNC940837-500 1x 500 µL

Ep-CAM / CD326 (EGP40/837), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details