Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar protein FliL (fliL)

This Recombinant Flagellar protein FliL (fliL) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Flagellar protein FliL

UniProt

P0ABX9

Expression Region

1-154

Origin

Escherichia coli O6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALD TFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKK NLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP5 Antibody
32694-01 50 µL

ACP5 Antibody

Sign In for Pricing
View Details
ACP5 Antibody
32694-02 100 µL

ACP5 Antibody

Sign In for Pricing
View Details
G6PC Rabbit Polyclonal Antibody (BF750)
orb1573213 100 µL

G6PC Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
PCMV-ZDHHC12 (human) -3xFLAG-Neo
BZ54737 1 Vial

PCMV-ZDHHC12 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
ZCCHC17, 1-241aa, Human, His tag, E Coli
MBS203827-01 0.01 mg

ZCCHC17, 1-241aa, Human, His tag, E Coli

Sign In for Pricing
View Details
ZCCHC17, 1-241aa, Human, His tag, E Coli
MBS203827-02 0.05 mg

ZCCHC17, 1-241aa, Human, His tag, E Coli

Sign In for Pricing
View Details