Recombinant Vaucheria litorea ATP synthase subunit b', chloroplastic (atpG)
This Recombinant Vaucheria litorea ATP synthase subunit b', chloroplastic (atpG) spans the amino acid sequence from region 1-154.
Product Specifications
Product Name Alternative
ATP synthase subunit b', chloroplastic, ATP synthase F (0) sector subunit b', ATPase subunit II
UniProt
B7T1R9
Expression Region
1-154
Origin
Vaucheria litorea (Chromophytic alga)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLKFSFLFLTVEKPGGLFDFDGTLPLIAIQFLILMFLLNILLYTPLLKIIDERSEYIANN LQEASIILNKANELSSQYEKEFSKIKKEVELDSLTLQNLHKNILEIEIISSQKIFENYLN QTINNFDSEKEKILTSLDEEINSLSSEIITKIVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040994-500 1x 500 µL
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040008-500 1x 500 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details