Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 SUSHI domain-containing protein E3 (E3)

This Recombinant Equine herpesvirus 2 SUSHI domain-containing protein E3 (E3) spans the amino acid sequence from region 21-174.

Product Specifications

Product Name Alternative

SUSHI domain-containing protein E3

UniProt

Q66608

Expression Region

21-174

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTPTPSKSTLIYNSQNCTTYPSIENGQSSLYYNGSWFIRYEFNCSSGYELQGWPYTTCIF WPKNGTIWTNGPPSCVKLNITTTLMPTSTSTTPVTTGTFPDPQNTTHPTHHTVKPTRRPI NLLRFGYTPWAIITLVVIILLVVWIVNCCMGPMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITRK6 (NM_032229) Human Over-expression Lysate
LY403151 100 µg

SLITRK6 (NM_032229) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Cdk16 activation kit by CRISPRa
GA203131 1 Kit

Mouse Cdk16 activation kit by CRISPRa

Sign In for Pricing
View Details
Skint4 Mouse Gene Knockout Kit (CRISPR)
KN515830 1 Kit

Skint4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDA Antibody
KC-1718-01 50 μL

CDA Antibody

Sign In for Pricing
View Details
CDA Antibody
KC-1718-02 100 µL

CDA Antibody

Sign In for Pricing
View Details
CDA Antibody
KC-1718-03 1 mL

CDA Antibody

Sign In for Pricing
View Details