Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0277605 (DDB_G0277605)

This Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0277605 (DDB_G0277605) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Uncharacterized protein DDB_G0277605

UniProt

Q86KR1

Expression Region

1-154

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNLKEKPLSYNINNNNLNNNNNNNNNNNNNNNNINNNINNNNFKYVSFSESLEDIGYQN QYIIDKDEDYYIQEQRYIRQNNQSDDEEDFNNNNYEDSIKISLIQKSFIKNKKNKIIITT IVVLLMIAVSLGLILAWQGVFDQIHNNNNNSKDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
BNC400718-500 1x 500 µL

HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details