Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q8CTM8

Expression Region

1-154

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIKDIVSLIASILIFLGSIIALISAIGIVKFQDVFLRSHASTKSSTLSVLLTVVGVLI YFIVNSGFFSVRLLLSLVFINLTSPVGMHLISRAAYRNGAYMYRKDDASRQSTILLSQKE FNTPEELKKRAKLREERREKLYYKEKEYINKMDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS501241 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
LNX2 Polyclonal Antibody
E-AB-66875-01 60 µL

LNX2 Polyclonal Antibody

Sign In for Pricing
View Details
LNX2 Polyclonal Antibody
E-AB-66875-02 120 µL

LNX2 Polyclonal Antibody

Sign In for Pricing
View Details
LNX2 Polyclonal Antibody
E-AB-66875-03 200 µL

LNX2 Polyclonal Antibody

Sign In for Pricing
View Details
Corticosterone Chemiluminescent ELISA Kit
K014-C5 5 Plates

Corticosterone Chemiluminescent ELISA Kit

Sign In for Pricing
View Details
Napsin-A (NAPSA/1238), 0.2mg/mL
BNUB1238-500 1x 500 µL

Napsin-A (NAPSA/1238), 0.2mg/mL

Sign In for Pricing
View Details