Recombinant Pig Melatonin receptor type 1A (MTNR1A)
This Recombinant Pig Melatonin receptor type 1A (MTNR1A) spans the amino acid sequence from region 1-154.
Product Specifications
Product Name Alternative
Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor
UniProt
O02781
Expression Region
1-154
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience; Pharmacology & Drug Discovery
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741274-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881686-100 1x 100 µL
VEGF (Vascular Endothelial Growth Factor) (VG1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP14229PU-N 400 µL
Cullin 5 (CUL5) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details