Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Melatonin receptor type 1A (MTNR1A)

This Recombinant Pig Melatonin receptor type 1A (MTNR1A) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor

UniProt

O02781

Expression Region

1-154

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Setd5 Mouse Gene Knockout Kit (CRISPR)
KN515628 1 Kit

Setd5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM45 Antibody
KC-28242-01 50 μL

TRIM45 Antibody

Sign In for Pricing
View Details
TRIM45 Antibody
KC-28242-02 100 µL

TRIM45 Antibody

Sign In for Pricing
View Details
TRIM45 Antibody
KC-28242-03 1 mL

TRIM45 Antibody

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF488A conjugate, 0.1mg/mL
BNC882318-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIGK (N-term) Rabbit Polyclonal Antibody
AP12208PU-N 400 µL

PIGK (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details