Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Melatonin receptor type 1A (MTNR1A)

This Recombinant Pig Melatonin receptor type 1A (MTNR1A) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor

UniProt

O02781

Expression Region

1-154

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS624339 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560707 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human AP2 beta (TFAP2B) activation kit by CRISPRa
GA104830 1 Kit

Human AP2 beta (TFAP2B) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509688 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Cat Mouse Gene Knockout Kit (CRISPR)
KN502579 1 Kit

Cat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Entpd6 activation kit by CRISPRa
GA200619 1 Kit

Mouse Entpd6 activation kit by CRISPRa

Sign In for Pricing
View Details