Recombinant Barley stripe mosaic virus Movement protein TGB3
This Recombinant Barley stripe mosaic virus Movement protein TGB3 spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
Movement protein TGB3, 17 kDa protein, Beta-C protein, Triple gene block 3 protein, TGBp3
UniProt
P04868
Expression Region
1-155
Origin
Barley stripe mosaic virus (BSMV)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAMPHPLECCCPQCLPSSESFPIYGEQEIPCSETQAETTPVEKTVRANVLTDILDDHYYA ILASLFIIALWLLYIYLSSIPTETGPYFYQDLNSVKIYGIGATNPEVIAAIHHWQKYPFG ESPMWGGLISVLSILLKPLTLVFALSFFLLLSSKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881045-500 1x 500 µL
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040994-100 1x 100 µL
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682951-500 1x 500 µL
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details