Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14)

This Recombinant Schizosaccharomyces pombe Uncharacterized transmembrane protein C1672.14 (SPCC1672.14) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein C1672.14

UniProt

G2TRU2

Expression Region

1-155

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESPRVEKEREKRTIRNVKNKKKKVSTYFILIIILWFISLFQLQQCNLHAYSNYYKVIF ILILITTLDSLPYSNYNAMIHLLISSNTLPLPPCFTLRASLFPPFITPLTHWNVGFVRLC NLFLSSHFHPLFHLTNSAPGSRQISTSLSNNTQST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL
BNC880898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details