Recombinant Mouse RING finger protein 122 (Rnf122)
This Recombinant Mouse RING finger protein 122 (Rnf122) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
RING finger protein 122
UniProt
Q8BP31
Expression Region
1-155
Origin
Mus musculus (Mouse)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL VKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2558-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), 0.2mg/mL
Sign In for Pricing
View Details 
KN200145RB 1 Kit
Ceramide synthase 2 (CERS2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
LY402781 100 µg
RepuLsive Guidance MolecuLe A (RGMA) (NM_020211) Human Over-expression Lysate
Sign In for Pricing
View Details 
