Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 122 (Rnf122)

This Recombinant Mouse RING finger protein 122 (Rnf122) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

RING finger protein 122

UniProt

Q8BP31

Expression Region

1-155

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFI SKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL VKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS705232 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody
RC-4901-01 50 μL

Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody

Sign In for Pricing
View Details
Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody
RC-4901-02 100 µL

Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody

Sign In for Pricing
View Details
Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody
RC-4901-03 1 mL

Recombinant PAK1 (phospho S144) /PAK2 (phospho S141) /PAK3 (phospho S154) Antibody

Sign In for Pricing
View Details
Ugt1a9 Mouse Gene Knockout Kit (CRISPR)
KN518670 1 Kit

Ugt1a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isonicotinic Acid
TRC-I821760-50G 50 g

Isonicotinic Acid

Sign In for Pricing
View Details