Recombinant Clostridium perfringens Large-conductance mechanosensitive channel (mscL)
This Recombinant Clostridium perfringens Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
Large-conductance mechanosensitive channel
UniProt
Q0SWK0
Expression Region
1-155
Origin
Clostridium perfringens (strain SM101 / Type A)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MWKEFKEFAMKGNVIDLAIGVIIGGAFGKIVTSLVNDIIMPVIGRLVGKVDFSNLYINLS GQQFNSLQEAQAAGAATINYGLFLNNLINFLIIAFSIFIVIKQINKLKNFTKKKEEVQVE ATEKDCPYCCTKIDIKATRCPHCTSVLEEATNQSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940641-500 1x 500 µL
Chromogranin A (LK2H10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details