Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat FUN14 domain-containing protein 1 (Fundc1)

This Recombinant Rat FUN14 domain-containing protein 1 (Fundc1) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

FUN14 domain-containing protein 1

UniProt

Q5BJS4

Expression Region

1-155

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATDFIKQNIVISSGFVGGFLLGLAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM89A activation kit by CRISPRa
GA117805 1 Kit

Human FAM89A activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560033 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
WDR21B (DCAF4L1) (NM_001029955) Human Over-expression Lysate
LC422271 20 µg

WDR21B (DCAF4L1) (NM_001029955) Human Over-expression Lysate

Sign In for Pricing
View Details
P70 S6 Kinase β (Ab-423) Antibody
8B8157-AAT 50 µg

P70 S6 Kinase β (Ab-423) Antibody

Sign In for Pricing
View Details
BANF1 (NM_003860) Human Over-expression Lysate
LY401269 100 µg

BANF1 (NM_003860) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS714693 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details