Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat FUN14 domain-containing protein 1 (Fundc1)

This Recombinant Rat FUN14 domain-containing protein 1 (Fundc1) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

FUN14 domain-containing protein 1

UniProt

Q5BJS4

Expression Region

1-155

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATDFIKQNIVISSGFVGGFLLGLAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-6,7-bis-(2-chloroethoxy)quinazoline
TRC-C365052-10MG 10 mg

4-Chloro-6,7-bis-(2-chloroethoxy)quinazoline

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), Biotin conjugate, 0.1mg/mL
BNCB1758-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RC-5860-01 50 μL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RC-5860-02 100 µL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RC-5860-03 1 mL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF568 conjugate, 0.1mg/mL
BNC682952-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details