Recombinant Human Uncharacterized protein C10orf111 (C10orf111)
This Recombinant Human Uncharacterized protein C10orf111 (C10orf111) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
Uncharacterized protein C10orf111
UniProt
Q8N326
Expression Region
1-155
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVH CGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLL PAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6350310-01 0.2 mL
SPANXE, ID (SPANXE, Sperm protein associated with the nucleus on the X chromosome E, Nuclear-associated protein SPAN-Xe, SPANX family member E) (AP)
Sign In for Pricing
View Details MBS6350310-02 5x 0.2 mL
SPANXE, ID (SPANXE, Sperm protein associated with the nucleus on the X chromosome E, Nuclear-associated protein SPAN-Xe, SPANX family member E) (AP)
Sign In for Pricing
View Details 
N001752 30 Pack (30 Marker (s) x 1 Roll)
EAUSANITAIRE450X52RL-T1-LL-P16 Pipe Markers for Water
Sign In for Pricing
View Details