Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse FUN14 domain-containing protein 1 (Fundc1)

This Recombinant Mouse FUN14 domain-containing protein 1 (Fundc1) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

FUN14 domain-containing protein 1

UniProt

Q9DB70

Expression Region

1-155

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATDFIKQNIVISSGFVGGFLLGLAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CamKII-RFP (Neo) Lentivirus
LVP1054-N 1x 10^7 IFU/mL - 200 μL

CamKII-RFP (Neo) Lentivirus

Sign In for Pricing
View Details
RPE Polyclonal Antibody
A66986-050 50 µL

RPE Polyclonal Antibody

Sign In for Pricing
View Details
Rat ovarian cancer marker-CA125 ELISA Kit
QY-E11197 96 Tests

Rat ovarian cancer marker-CA125 ELISA Kit

Sign In for Pricing
View Details
Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)
MBS1018813-01 0.02 mg (E-Coli)

Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)
MBS1018813-02 0.1 mg (E-Coli)

Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)
MBS1018813-03 0.02 mg (Yeast)

Recombinant Tolumonas auensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details