Recombinant Swinepox virus E3 ubiquitin-protein ligase LAP (LAP)
This Recombinant Swinepox virus E3 ubiquitin-protein ligase LAP (LAP) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase LAP, EC= 6.3.2.-, Leukemia associated protein, LAP
UniProt
P32225
Expression Region
1-155
Origin
Swinepox virus (strain Kasza) (SWPV)
Field of Research
Infectious Disease & Virology; Molecular Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDPVCWICKDDYSIEKNYCNCKNEYKVVHDECMKKWIQYSRERSCKLCNKEYNIISVRKP FSQWVFSIKDCKKSAILYATLFLCTFIISLVLTRINITKIIDTSKNDVSFKLVTMIFYLL PFVITCISFITLIVYLYKYCKISAKNNTYDTIYEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 