Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein (YMF18)

This Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein (YMF18) spans the amino acid sequence from region 1-155.

Product Specifications

Product Name Alternative

Putative ATP synthase protein YMF19-like protein, ORF 155

UniProt

P38461

Expression Region

1-155

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLCRTNVLHLRPQLNKFTYLTQFLWLCLFYITFYFVLYSVLVFTNTEWPFILLKKRLVSQ EKIRAYQSNDCVGQTRGLTSEPSWRDACWRALILAYLTSIYFFPILGSFPRVLKDQVDFG YIPTVCILLYVIFLFFFDSYRKSLFTTALTHSFWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-1β (Interleukin 1 Beta) ELISA Kit
E-EL-R0012-01 24 Tests

Rat IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Rat IL-1β (Interleukin 1 Beta) ELISA Kit
E-EL-R0012-02 48 Tests

Rat IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Rat IL-1β (Interleukin 1 Beta) ELISA Kit
E-EL-R0012-03 96 Tests

Rat IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse CD45 (I3/2.3) In Vivo Antibody - Low Endotoxin
ICH1057-5mg 5 mg

Anti-Mouse CD45 (I3/2.3) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Mouse Topoisomerase I (TOP1) ELISA Kit
RD-TOP1-Mu-01 96 Tests

Mouse Topoisomerase I (TOP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Topoisomerase I (TOP1) ELISA Kit
RD-TOP1-Mu-02 48 Tests

Mouse Topoisomerase I (TOP1) ELISA Kit

Sign In for Pricing
View Details