Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein (YMF18)
This Recombinant Marchantia polymorpha Putative ATP synthase protein YMF19-like protein (YMF18) spans the amino acid sequence from region 1-155.
Product Specifications
Product Name Alternative
Putative ATP synthase protein YMF19-like protein, ORF 155
UniProt
P38461
Expression Region
1-155
Origin
Marchantia polymorpha (Liverwort) (Marchantia aquatica)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLCRTNVLHLRPQLNKFTYLTQFLWLCLFYITFYFVLYSVLVFTNTEWPFILLKKRLVSQ EKIRAYQSNDCVGQTRGLTSEPSWRDACWRALILAYLTSIYFFPILGSFPRVLKDQVDFG YIPTVCILLYVIFLFFFDSYRKSLFTTALTHSFWL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-403-20 1 mL
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2c, 20nm
Sign In for Pricing
View Details 
GAF-013-10 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Goat IgG, 10nm
Sign In for Pricing
View Details 