Recombinant Escherichia coli Inner membrane protein ylaC (ylaC)
This Recombinant Escherichia coli Inner membrane protein ylaC (ylaC) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
Inner membrane protein ylaC
UniProt
P0AAS0
Expression Region
1-156
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLS GSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNS PRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470460-500 1x 500 µL
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742115-100 1x 100 µL
Cytokeratin 8 (KRT8) (KRT8/2115), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041074-500 1x 500 µL
SOX10 (SOX10/991 + SOX10/1074), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 