What is the catalog number for Recombinant Inner membrane protein ylaC (ylaC)?

The catalog number for Recombinant Inner membrane protein ylaC (ylaC) is orb2931429.

What sizes are available for Recombinant Inner membrane protein ylaC (ylaC)?

Recombinant Inner membrane protein ylaC (ylaC) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Inner membrane protein ylaC (ylaC) come in?

Recombinant Inner membrane protein ylaC (ylaC) is available in 2 different pack sizes.

Is Recombinant Inner membrane protein ylaC (ylaC) in stock?

Recombinant Inner membrane protein ylaC (ylaC) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Inner membrane protein ylaC (ylaC)

This Recombinant Inner membrane protein ylaC (ylaC) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Inner membrane protein ylaC

UniProt

P0AAS2

Expression Region

1-156

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLS GSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNS PRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS