Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic (atpG)
This Recombinant Phaeodactylum tricornutum ATP synthase subunit b', chloroplastic (atpG) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b', chloroplastic, ATP synthase F (0) sector subunit b', ATPase subunit II
UniProt
A0T0E8
Expression Region
1-156
Origin
Phaeodactylum tricornutum (strain CCAP 1055/1)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MINISMLISNSEVSGPGGLFDFNATLPLVAIQFILLMVLLNILLYNPLLTIIEERKEYIL TNLGKASELLSEANKLTQQYEQELDNVRKEAQLEITNSQKIHKEILEVELNISQKYIDNL LDTIQKDLLAKKNIALNSLDEIVQSLCVDIEARLSI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680050-500 1x 500 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400994-500 1x 500 µL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details