Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b', chloroplastic (atpG)

This Recombinant ATP synthase subunit b', chloroplastic (atpG) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b', chloroplastic, ATP synthase F (0) sector subunit b', ATPase subunit II

UniProt

Q1XDP2

Expression Region

1-156

Origin

Porphyra yezoensis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDLPFLLAEEIEGGLFDFNGTLPLMALQFLTLMVLLNTIFYKPVTKVLDERDEYIRTTL TTASSMLVKADELAAKYEEDLSEARRNAQLKIASSQKEAQNIVSEDIKKAQLNAEKLIAE ASKQLNVQKEEALKTLENQVDTLSDQIKVKLLSSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Retina, Peptide Aptamer, FITC labelled
AP-324-F 1 mg

Mouse Retina, Peptide Aptamer, FITC labelled

Sign In for Pricing
View Details
TDO2 3'UTR Luciferase Stable Cell Line
TU025371 1.0 mL

TDO2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PIM1 Rabbit mAb
orb1923654-01 20 ul

PIM1 Rabbit mAb

Sign In for Pricing
View Details
PIM1 Rabbit mAb
orb1923654-02 50 µL

PIM1 Rabbit mAb

Sign In for Pricing
View Details
PIM1 Rabbit mAb
orb1923654-03 100 µL

PIM1 Rabbit mAb

Sign In for Pricing
View Details
Thymidylate Synthase Antibody
orb1318621 100 µL

Thymidylate Synthase Antibody

Sign In for Pricing
View Details