Recombinant Shigella dysenteriae serotype 1 ATP synthase subunit b (atpF)
This Recombinant Shigella dysenteriae serotype 1 ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q329S5
Expression Region
1-156
Origin
Shigella dysenteriae serotype 1 (strain Sd197)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880008-500 1x 500 µL
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402624-500 1x 500 µL
MUC16 / CA125 (Ovarian Carcinoma Marker) (500000000000), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400173-500 1x 500 µL
CD45 / LCA (136-4B5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details