Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit b (atpF)

This Recombinant Pseudomonas fluorescens ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q3K437

Expression Region

1-156

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINATLIGQSVAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK AGQQLREAKAQAAEIIEQAKKRGNQIVEEAVEKARIDADRVKVQAQAEIEQELNSVKDKL RAQVGLLAVGGAEKILGATIDQNAHAELVNQLAAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vildagliptin Lactam
TRC-V305025-50MG 50 mg

Vildagliptin Lactam

Sign In for Pricing
View Details
Biological Microscope BMIC-502
BMIC-502 1 Unit

Biological Microscope BMIC-502

Sign In for Pricing
View Details
Human BAFF Receptor (TNFRSF13C) activation kit by CRISPRa
GA114535 1 Kit

Human BAFF Receptor (TNFRSF13C) activation kit by CRISPRa

Sign In for Pricing
View Details
2'-Nitro-p-acetanisidide-15N
TRC-N490287-10MG 10 mg

2'-Nitro-p-acetanisidide-15N

Sign In for Pricing
View Details
FGFR1 (NM_023108) Human Recombinant Protein
TP314979M 100 µg

FGFR1 (NM_023108) Human Recombinant Protein

Sign In for Pricing
View Details
FGFR2 (NM_022970) Human Over-expression Lysate
LY402962 100 µg

FGFR2 (NM_022970) Human Over-expression Lysate

Sign In for Pricing
View Details