Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus ATP synthase subunit b (atpF)

This Recombinant Psychrobacter arcticus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q4FQ33

Expression Region

1-156

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERD VQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQAAIDQEINQARESL RAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2
MBS502239-01 0.1 mL

SOX2

Sign In for Pricing
View Details
SOX2
MBS502239-02 5x 0.1 mL

SOX2

Sign In for Pricing
View Details
ELL2 Antibody
C18448-01 50 μL

ELL2 Antibody

Sign In for Pricing
View Details
ELL2 Antibody
C18448-02 100 µL

ELL2 Antibody

Sign In for Pricing
View Details
USP7 Mouse Monoclonal Antibody
orb2988046-01 30 µL

USP7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
USP7 Mouse Monoclonal Antibody
orb2988046-02 50 µL

USP7 Mouse Monoclonal Antibody

Sign In for Pricing
View Details