Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit b (atpF)

This Recombinant Pseudomonas fluorescens ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q4K3A5

Expression Region

1-156

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINATLIGQSVAFLIFVLFCMKFIWPPVIAALHERQKKIADGLDAASRAARDLELAQDK AGQQLREAKAQAAEIIEQAKKRGSQIVDEAREQARVEAERVKAQAQAEIEQELNGVKDAL RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IceRacks
R8013 6 Units/Case

IceRacks

Sign In for Pricing
View Details
Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein
abx655259-01 100 µg

Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein

Sign In for Pricing
View Details
Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein
abx655259-02 200 µg

Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein

Sign In for Pricing
View Details
Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein
abx655259-03 500 µg

Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein

Sign In for Pricing
View Details
Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein
abx655259-04 1 mg

Pig Metalloproteinase Inhibitor 3 (TIMP3) Protein

Sign In for Pricing
View Details
Anti-4-1BBL/Tnfsf9 Antibody Picoband® (Biotine Conjugate)
A06032-2-Biotin 100 µg/Vial

Anti-4-1BBL/Tnfsf9 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details