Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q663Q4

Expression Region

1-156

Origin

Yersinia pseudotuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOS (CBARP) Human qPCR Template Standard (NM_152769)
HK201312 1 Kit

DOS (CBARP) Human qPCR Template Standard (NM_152769)

Sign In for Pricing
View Details
Lentiviral mouse Zfp771 shRNA (UAS) - Lentiviral mouse Zfp771 shRNA (UAS, GFP) plasmid
GTR15190402 1 Vial

Lentiviral mouse Zfp771 shRNA (UAS) - Lentiviral mouse Zfp771 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human KIR2DL1/CD158a Allophycocyanin MAb (Clone 143211)
FAB1844A-025 25 Tests

Human KIR2DL1/CD158a Allophycocyanin MAb (Clone 143211)

Sign In for Pricing
View Details
Hint1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5027804 1.0 µg DNA

Hint1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
EPHA2/5 (Ab-594) Antibody
33309-01 50 µL

EPHA2/5 (Ab-594) Antibody

Sign In for Pricing
View Details
EPHA2/5 (Ab-594) Antibody
33309-02 100 µL

EPHA2/5 (Ab-594) Antibody

Sign In for Pricing
View Details