Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q663Q4

Expression Region

1-156

Origin

Yersinia pseudotuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem184c Pre-designed siRNA Set A
SI114813A 1 Each

Mouse Tmem184c Pre-designed siRNA Set A

Sign In for Pricing
View Details
Benitrobenrazide
MBS5812173 Inquire

Benitrobenrazide

Sign In for Pricing
View Details
DDO (D-Aspartate Oxidase, DASOX, FLJ45203) (MaxLight 550)
125713-ML550 100 µL

DDO (D-Aspartate Oxidase, DASOX, FLJ45203) (MaxLight 550)

Sign In for Pricing
View Details
MRPL48, NT (MRPL48, 39S ribosomal protein L48, mitochondrial) (AP) discontinued
038600-AP 200 µL

MRPL48, NT (MRPL48, 39S ribosomal protein L48, mitochondrial) (AP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CXCL1/GRO alpha/KC/CINC-1 Antibody (20326) [PerCP]
FAB275C 0.1 mL

Mouse Monoclonal CXCL1/GRO alpha/KC/CINC-1 Antibody (20326) [PerCP]

Sign In for Pricing
View Details
PLAUR Antibody FITC Conjugated
MBS9460845-01 0.1 mL

PLAUR Antibody FITC Conjugated

Sign In for Pricing
View Details