Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF)

This Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q5PKW8

Expression Region

1-156

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS804821 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
12-Crown-4
TRC-C790010-500MG 500 mg

12-Crown-4

Sign In for Pricing
View Details
FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181C-01 50 Tests

FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181C-02 100 Tests

FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181C-03 2x 100 Tests

FITC Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
FGFR2 (C-term) Rabbit Polyclonal Antibody
AP23313PU-N 100 µg

FGFR2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details