Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7CFM4

Expression Region

1-156

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nickel boride
TRC-N901138-5G 5 g

Nickel boride

Sign In for Pricing
View Details
23-(9-Mercaptononyl)-3,6,9,12,15,18,21-heptaoxatricosanoic Acid (>85%)
TRC-M254255-10MG 10 mg

23-(9-Mercaptononyl)-3,6,9,12,15,18,21-heptaoxatricosanoic Acid (>85%)

Sign In for Pricing
View Details
Lamin A/C Monoclonal Antibody
AN005340L-01 25 µL

Lamin A/C Monoclonal Antibody

Sign In for Pricing
View Details
Lamin A/C Monoclonal Antibody
AN005340L-02 100 µL

Lamin A/C Monoclonal Antibody

Sign In for Pricing
View Details
6-Aza-2-thiouridine
TRC-A803358-5MG 5 mg

6-Aza-2-thiouridine

Sign In for Pricing
View Details
3-Hydroxybenzyl Alcohol
TRC-H809705-5G 5 g

3-Hydroxybenzyl Alcohol

Sign In for Pricing
View Details