Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Human (HEK293, His)

PD-L1 Protein is an important immunoregulatory molecule and a member of the B7 superfamily. As the primary ligand of PD-1, PD-L1 Protein can bind to PD-1 to inhibit T-cell activation, proliferation, and cytokine secretion, and induce T-cell apoptosis. PD-L1 Protein plays a key role in tumor immune escape and immune homeostasis regulation. PD-L1 Protein, Human (HEK293, His) is a recombinant PD-L1 protein expressed by HEK293 with a C-His His tag[1][2][3].

Product Specifications

Product Name Alternative

PD-L1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-human-hek293-his.html

Purity

98.0

Smiles

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH

Molecular Formula

29126 (Gene_ID) Q9NZQ7-1 (F19-T239) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

References & Citations

[1]Chemnitz JM, et al. SHP-1 and SHP-2 associate with immunoreceptor tyrosine-based switch motif of programmed death 1 upon primary human T cell stimulation, but only receptor ligation prevents T cell activation. J Immunol. 2004 Jul 15;173 (2) :945-54.|[2]Han Y, et al. PD-1/PD-L1 pathway: current researches in cancer. Am J Cancer Res. 2020 Mar 1;10 (3) :727-742.|[3]Kythreotou A, et al. PD-L1. Journal of clinical pathology, 2018, 71 (3) : 189-194.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NIK (Thr559) Antibody
MBS9612620-01 0.1 mL

Phospho-NIK (Thr559) Antibody

Sign In for Pricing
View Details
Phospho-NIK (Thr559) Antibody
MBS9612620-02 0.2 mL

Phospho-NIK (Thr559) Antibody

Sign In for Pricing
View Details
Phospho-NIK (Thr559) Antibody
MBS9612620-03 5x 0.2 mL

Phospho-NIK (Thr559) Antibody

Sign In for Pricing
View Details
ACTC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0035705 3x 1.0 µg

ACTC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)
MF-0102727-01 5 µg

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)

Sign In for Pricing
View Details
Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)
MF-0102727-02 10 µg

Bovine coronavirus (strain OK-0514) Spike glycoprotein (His)

Sign In for Pricing
View Details