Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Human (HEK293, His)

PD-L1 Protein is an important immunoregulatory molecule and a member of the B7 superfamily. As the primary ligand of PD-1, PD-L1 Protein can bind to PD-1 to inhibit T-cell activation, proliferation, and cytokine secretion, and induce T-cell apoptosis. PD-L1 Protein plays a key role in tumor immune escape and immune homeostasis regulation. PD-L1 Protein, Human (HEK293, His) is a recombinant PD-L1 protein expressed by HEK293 with a C-His His tag[1][2][3].

Product Specifications

Product Name Alternative

PD-L1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-human-hek293-his.html

Purity

98.0

Smiles

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH

Molecular Formula

29126 (Gene_ID) Q9NZQ7-1 (F19-T239) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

References & Citations

[1]Chemnitz JM, et al. SHP-1 and SHP-2 associate with immunoreceptor tyrosine-based switch motif of programmed death 1 upon primary human T cell stimulation, but only receptor ligation prevents T cell activation. J Immunol. 2004 Jul 15;173 (2) :945-54.|[2]Han Y, et al. PD-1/PD-L1 pathway: current researches in cancer. Am J Cancer Res. 2020 Mar 1;10 (3) :727-742.|[3]Kythreotou A, et al. PD-L1. Journal of clinical pathology, 2018, 71 (3) : 189-194.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)
MBS7037384-01 0.02 mg

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)
MBS7037384-02 0.1 mg

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)
MBS7037384-03 5x 0.1 mg

Recombinant Dictyostelium discoideum Putative ZDHHC-type palmitoyltransferase 7 (DDB_G0276017)

Sign In for Pricing
View Details
NKX2.3 (NKX2-3) Human qPCR Primer Pair (NM_145285)
HP217458 200 Reactions

NKX2.3 (NKX2-3) Human qPCR Primer Pair (NM_145285)

Sign In for Pricing
View Details
Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody
TA371503 100 µL

Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Syntaphilin Antibody [DyLight 755]
NBP2-98037IR 0.1 mL

Rabbit Polyclonal Syntaphilin Antibody [DyLight 755]

Sign In for Pricing
View Details