Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Human (HEK293, His)

PD-L1 Protein is an important immunoregulatory molecule and a member of the B7 superfamily. As the primary ligand of PD-1, PD-L1 Protein can bind to PD-1 to inhibit T-cell activation, proliferation, and cytokine secretion, and induce T-cell apoptosis. PD-L1 Protein plays a key role in tumor immune escape and immune homeostasis regulation. PD-L1 Protein, Human (HEK293, His) is a recombinant PD-L1 protein expressed by HEK293 with a C-His His tag[1][2][3].

Product Specifications

Product Name Alternative

PD-L1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-human-hek293-his.html

Purity

98.0

Smiles

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHHHHHH

Molecular Formula

29126 (Gene_ID) Q9NZQ7-1 (F19-T239) (Accession)

Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

References & Citations

[1]Chemnitz JM, et al. SHP-1 and SHP-2 associate with immunoreceptor tyrosine-based switch motif of programmed death 1 upon primary human T cell stimulation, but only receptor ligation prevents T cell activation. J Immunol. 2004 Jul 15;173 (2) :945-54.|[2]Han Y, et al. PD-1/PD-L1 pathway: current researches in cancer. Am J Cancer Res. 2020 Mar 1;10 (3) :727-742.|[3]Kythreotou A, et al. PD-L1. Journal of clinical pathology, 2018, 71 (3) : 189-194.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DMGDH Antibody
NBP2-32666 0.1 mL

Rabbit Polyclonal DMGDH Antibody

Sign In for Pricing
View Details
Hsa-miR-6821-3p inhibitor
HY-RI02206-01 5 nmol

Hsa-miR-6821-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-6821-3p inhibitor
HY-RI02206-02 20 nmol

Hsa-miR-6821-3p inhibitor

Sign In for Pricing
View Details
Lentiviral mouse Rassf2 shRNA (UAS) - Lentiviral mouse Rassf2 shRNA (UAS, RFP) (25)
GTR15227735 1 Vial

Lentiviral mouse Rassf2 shRNA (UAS) - Lentiviral mouse Rassf2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Apolipoprotein A V Polyclonal Antibody, PerCP Conjugated
bs-5035R-PerCP 100 µL

Apolipoprotein A V Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Recombinant Arthrobacter sp. ATP synthase subunit b (atpF)
MBS7009496-01 0.02 mg

Recombinant Arthrobacter sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details