Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium ATP synthase subunit b (atpF)

This Recombinant Salmonella typhimurium ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7CPE4

Expression Region

1-156

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-100 1x 100 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), CF568 conjugate, 0.1mg/mL
BNC680227-500 1x 500 µL

Milk Fat Globulin (MFG-06), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL
BNC402123-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details