Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit b (atpF)

This Recombinant Pseudomonas putida ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q88BX0

Expression Region

1-156

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK AGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQALAEIEQELNSAKDAL RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PARP10 activation kit by CRISPRa
GA113732 1 Kit

Human PARP10 activation kit by CRISPRa

Sign In for Pricing
View Details
D-Luciferin, FREE ACID
#10100 1x 10 mg

D-Luciferin, FREE ACID

Sign In for Pricing
View Details
FHL2 (NM_001039492) Human Recombinant Protein
TP760738 50 µg

FHL2 (NM_001039492) Human Recombinant Protein

Sign In for Pricing
View Details
GPR133 Antibody
8G292-AAT 50 µg

GPR133 Antibody

Sign In for Pricing
View Details
WNK4 Human Gene Knockout Kit (CRISPR)
KN423269 1 Kit

WNK4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Alpha 1 microglobULin (AMBP) activation kit by CRISPRa
GA100178 1 Kit

Human Alpha 1 microglobULin (AMBP) activation kit by CRISPRa

Sign In for Pricing
View Details