What is the catalog number for Recombinant Rat Melatonin receptor type 1A (Mtnr1a)?

The catalog number for Recombinant Rat Melatonin receptor type 1A (Mtnr1a) is orb2931375.

What sizes are available for Recombinant Rat Melatonin receptor type 1A (Mtnr1a)?

Recombinant Rat Melatonin receptor type 1A (Mtnr1a) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Rat Melatonin receptor type 1A (Mtnr1a) come in?

Recombinant Rat Melatonin receptor type 1A (Mtnr1a) is available in 2 different pack sizes.

Is Recombinant Rat Melatonin receptor type 1A (Mtnr1a) in stock?

Recombinant Rat Melatonin receptor type 1A (Mtnr1a) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Rat Melatonin receptor type 1A (Mtnr1a)

This Recombinant Rat Melatonin receptor type 1A (Mtnr1a) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Melatonin receptor type 1A, Mel-1A-R, Mel1a receptor

UniProt

P49218

Expression Region

1-156

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CYICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYSCTFTQSVSSA YTIALVVFHFVVPMIIVTFCYLRIWILVLQVRRRVKPDSKPKLKPQDFRNFVTMFVVFVL FALCWAPLNFIGLIVASDPATMAPRIPEWLFVASYY