Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P0ABA1

Expression Region

1-156

Origin

Escherichia coli O6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)
AP75193-01 10 µg

Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)
AP75193-02 50 µg

Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)
AP75193-03 500 µg

Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)
AP75193-04 1 mg

Recombinant Human Poliovirus Receptor-Related Protein 1/PVRL1 (C-6His)

Sign In for Pricing
View Details
GSTM2 Rabbit Polyclonal Antibody (FITC)
orb2123148 100 µL

GSTM2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD79a, Antibody
GWB-F66D50 7 mL

CD79a, Antibody

Sign In for Pricing
View Details