Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P0ABA3

Expression Region

1-156

Origin

Shigella flexneri

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTX2 Monoclonal Antibody
RA11774-01 50 µL

OTX2 Monoclonal Antibody

Sign In for Pricing
View Details
OTX2 Monoclonal Antibody
RA11774-02 100 µL

OTX2 Monoclonal Antibody

Sign In for Pricing
View Details
Canine Vitamin D3 receptor (VDR) ELISA Kit
GTR10324706 96 Well

Canine Vitamin D3 receptor (VDR) ELISA Kit

Sign In for Pricing
View Details
Ethyl 2-bromo-3-phenylpropanoate
sc-353428 250 mg

Ethyl 2-bromo-3-phenylpropanoate

Sign In for Pricing
View Details
IL-32A Interleukin-32 alpha Human Recombinant Protein , His Tag
PROTP24001-1 20 µg

IL-32A Interleukin-32 alpha Human Recombinant Protein , His Tag

Sign In for Pricing
View Details
Rat Cytochrome P450 1A1 (CYP1A1) CLIA Kit
abx494189-01 96 Tests

Rat Cytochrome P450 1A1 (CYP1A1) CLIA Kit

Sign In for Pricing
View Details