Recombinant ATP synthase subunit b (atpF)
This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
P0ABA2
Expression Region
1-156
Origin
Escherichia coli O157:H7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A884560-50MG 50 mg
6-Azido-1,6-dideoxy-3,4-O-isopropylidene-D-lyxo-2-hexulofuranose
Sign In for Pricing
View Details 
BNC471670-500 1x 500 µL
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682363-100 1x 100 µL
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 