Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marinobacter aquaeolei ATP synthase subunit b (atpF)

This Recombinant Marinobacter aquaeolei ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1U7H8

Expression Region

1-156

Origin

Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLTLIGQSIAFAIFVWFCVKYVWPPITAAMEARQKKIADGLSAADRASLDLELAQEK ATKELQKAKEEAAALIDQANKRAAQIVEASKEDARKEGEKLIEQARAEIQQERVQARDAL RAEVATLAVAGAEKILETSVDAKAHSEMLEKLAAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL2 Antibody
KC-1764-01 50 μL

CCL2 Antibody

Sign In for Pricing
View Details
CCL2 Antibody
KC-1764-02 100 µL

CCL2 Antibody

Sign In for Pricing
View Details
CCL2 Antibody
KC-1764-03 1 mL

CCL2 Antibody

Sign In for Pricing
View Details
Cfp Mouse Gene Knockout Kit (CRISPR)
KN503219 1 Kit

Cfp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DKK4 (C-term) Rabbit Polyclonal Antibody
AP11557PU-N 400 µL

DKK4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CD34 Antibody
RC-16783-01 50 μL

Recombinant CD34 Antibody

Sign In for Pricing
View Details