Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF)

This Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4VS66

Expression Region

1-156

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLTLFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDK VSHTLRETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQL RSQVAALAVAGAEKILESQVDAKVHNELVEKLASQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purine
TRC-P840288-500MG 500 mg

Purine

Sign In for Pricing
View Details
Mouse Prdx6 activation kit by CRISPRa
GA200201 1 Kit

Mouse Prdx6 activation kit by CRISPRa

Sign In for Pricing
View Details
POLR3D Rabbit Polyclonal Antibody
AP21167PU-N 100 µg

POLR3D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSEN2 Polyclonal Antibody
E-AB-52966-01 20 µL

TSEN2 Polyclonal Antibody

Sign In for Pricing
View Details
TSEN2 Polyclonal Antibody
E-AB-52966-02 60 µL

TSEN2 Polyclonal Antibody

Sign In for Pricing
View Details
TSEN2 Polyclonal Antibody
E-AB-52966-03 120 µL

TSEN2 Polyclonal Antibody

Sign In for Pricing
View Details