Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF)

This Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4VS66

Expression Region

1-156

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLTLFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDK VSHTLRETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQL RSQVAALAVAGAEKILESQVDAKVHNELVEKLASQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc138 Mouse Gene Knockout Kit (CRISPR)
KN502659 1 Kit

Ccdc138 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL
BNC681203-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]
E-AB-F1385J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]
E-AB-F1385J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]
E-AB-F1385J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD192/CCR2 Antibody[K036C2]

Sign In for Pricing
View Details
Mirabegron O-Glucuronide Sodium Salt
TRC-M364906-5MG 5 mg

Mirabegron O-Glucuronide Sodium Salt

Sign In for Pricing
View Details