Recombinant Enterobacter sp. ATP synthase subunit b (atpF)
This Recombinant Enterobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A4WGF1
Expression Region
1-156
Origin
Enterobacter sp. (strain 638)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNMNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP14199PU-N 400 µL
AlaRS (AARS) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC942025-100 1x 100 µL
MMP9 (MMP9/2025R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941222-500 1x 500 µL
UACA / Nucling (UACA/1222), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC424732 20 µg
IL2 Receptor alpha (IL2RA) (NM_000417) Human Over-expression Lysate
Sign In for Pricing
View Details