Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. ATP synthase subunit b (atpF)

This Recombinant Enterobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4WGF1

Expression Region

1-156

Origin

Enterobacter sp. (strain 638)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itgb1 Mouse Gene Knockout Kit (CRISPR)
KN308488LP 1 Kit

Itgb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZHX2 Rabbit Polyclonal Antibody
ER1901-64 100 µL

ZHX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LEPROTL1 activation kit by CRISPRa
GA108339 1 Kit

Human LEPROTL1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNHIT1 antibody
FNab09744 100 µg

ZNHIT1 antibody

Sign In for Pricing
View Details
Recombinant Human ALCAM/CD166 Protein (His Tag)
PKSH031919 100 µg

Recombinant Human ALCAM/CD166 Protein (His Tag)

Sign In for Pricing
View Details
Human NPAS4 activation kit by CRISPRa
GA116949 1 Kit

Human NPAS4 activation kit by CRISPRa

Sign In for Pricing
View Details