Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. ATP synthase subunit b (atpF)

This Recombinant Psychrobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5WBV7

Expression Region

1-156

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLTLIGQSIAFAIFVLFCMKFIWPALMGAISERQQKIADGLNAAEKAKADLASAEQS VEQELATAKAKAAALIEQANKSANQLIEEAKAQAQVEGERIRQQARESIDLEINQARESL RTQVSELAVLGAEQILKEKVDQQTHANMLNELAAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-T7-GSDMD-3×FLAG-Neo Plasmid
PVT48966 2 µg

pCMV-T7-GSDMD-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
Sheep Interferon α (IFN-α) ELISA Kit
YLA0157SH-01 48 Tests

Sheep Interferon α (IFN-α) ELISA Kit

Sign In for Pricing
View Details
Sheep Interferon α (IFN-α) ELISA Kit
YLA0157SH-02 96 Tests

Sheep Interferon α (IFN-α) ELISA Kit

Sign In for Pricing
View Details
Anti-IL4RA (stapokibart biosimilar) mAb
12-90321-100 100 µg

Anti-IL4RA (stapokibart biosimilar) mAb

Sign In for Pricing
View Details
CHAC1 Rabbit Polyclonal Antibody (BF647)
orb2397699 100 µL

CHAC1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody [Clone ID: OTI2F2]
CF814543 100 µg

GFAP Mouse Monoclonal Antibody [Clone ID: OTI2F2]

Sign In for Pricing
View Details