Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri ATP synthase subunit b (atpF)

This Recombinant Citrobacter koseri ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A8ACP2

Expression Region

1-156

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK2 Mouse Monoclonal Antibody [Clone ID: OTI7D12]
CF806794 100 µg

JAK2 Mouse Monoclonal Antibody [Clone ID: OTI7D12]

Sign In for Pricing
View Details
Anti-KATNB1
Y058916 100 µg

Anti-KATNB1

Sign In for Pricing
View Details
APC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783E-01 25 µg

APC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
APC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783E-02 100 µg

APC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Human ZDHHC19 activation kit by CRISPRa
GA115147 1 Kit

Human ZDHHC19 activation kit by CRISPRa

Sign In for Pricing
View Details
Cy3NS acid *CAS 1032678-01-5*
190-AAT 100 mg

Cy3NS acid *CAS 1032678-01-5*

Sign In for Pricing
View Details