Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri ATP synthase subunit b (atpF)

This Recombinant Citrobacter koseri ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A8ACP2

Expression Region

1-156

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIDAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/2756R), CF405S conjugate, 0.1mg/mL
BNC042756-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/2756R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NR0B1 (NM_000475) Human Recombinant Protein
TP304187 20 µg

NR0B1 (NM_000475) Human Recombinant Protein

Sign In for Pricing
View Details
Human CTRP5 (C1QTNF5) activation kit by CRISPRa
GA114490 1 Kit

Human CTRP5 (C1QTNF5) activation kit by CRISPRa

Sign In for Pricing
View Details
3-Hydroxy-DL-Kynurenine
TRC-H950758-25MG 25 mg

3-Hydroxy-DL-Kynurenine

Sign In for Pricing
View Details
Datura Stramonium Lectin (DSL), CF®568 Conjugate
#29098 1x 1 mL

Datura Stramonium Lectin (DSL), CF®568 Conjugate

Sign In for Pricing
View Details
Xrcc2 Mouse Gene Knockout Kit (CRISPR)
KN519521 1 Kit

Xrcc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details