Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF)

This Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B5BIP0

Expression Region

1-156

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPRIPL2 (NM_001034841) Human Over-expression Lysate
LY421966 100 µg

ITPRIPL2 (NM_001034841) Human Over-expression Lysate

Sign In for Pricing
View Details
n-Butyraldehyde-2,2,3,3,4,4,4-d7
TRC-B689899-5MG 5 mg

n-Butyraldehyde-2,2,3,3,4,4,4-d7

Sign In for Pricing
View Details
Human ZMAT2 activation kit by CRISPRa
GA115864 1 Kit

Human ZMAT2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559803 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
LDB3 (NM_001080116) Human Recombinant Protein
TP323167L 1 mg

LDB3 (NM_001080116) Human Recombinant Protein

Sign In for Pricing
View Details
RPS6KA3 (NM_004586) Human Recombinant Protein
TP313645L 1 mg

RPS6KA3 (NM_004586) Human Recombinant Protein

Sign In for Pricing
View Details